Lineage for d1tp8.4 (1tp8 H:,G:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 470062Fold b.77: beta-Prism I [51091] (3 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 470080Superfamily b.77.3: Mannose-binding lectins [51101] (1 family) (S)
  5. 470081Family b.77.3.1: Mannose-binding lectins [51102] (5 proteins)
  6. 470121Protein Jacalin [51103] (2 species)
  7. 470122Species Artocarpus hirsuta [TaxId:291940] [110308] (2 PDB entries)
  8. 470130Domain d1tp8.4: 1tp8 H:,G: [107188]

Details for d1tp8.4

PDB Entry: 1tp8 (more details), 3 Å

PDB Description: crystal structure of a galactose specific lectin from artocarpus hirsuta in complex with methyl-a-d-galactose

SCOP Domain Sequences for d1tp8.4:

Sequence; same for both SEQRES and ATOM records: (download)

>g1tp8.4 b.77.3.1 (H:,G:) Jacalin {Artocarpus hirsuta}
sgksqtvivgpwgakvXgkafddgaftgireinlsynketaigdfqvvydlngspyvgqn
hssfisgftpvkisldfpseyitevsgytgnvsgyvvvrsltfktnkktygpygvtsgtp
fnlpienglivgfkgsigywmdyfsmylsl

SCOP Domain Coordinates for d1tp8.4:

Click to download the PDB-style file with coordinates for d1tp8.4.
(The format of our PDB-style files is described here.)

Timeline for d1tp8.4: