![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.77: beta-Prism I [51091] (4 superfamilies) consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis duplication: has internal pseudo threefold symmetry |
![]() | Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) ![]() |
![]() | Family b.77.3.1: Mannose-binding lectins [51102] (7 proteins) |
![]() | Protein Jacalin [51103] (2 species) |
![]() | Species Artocarpus hirsuta [TaxId:291940] [110308] (2 PDB entries) Uniprot Q38723 64-217 95% sequence identity |
![]() | Domain d1tp8.3: 1tp8 F:,E: [107187] complexed with amg |
PDB Entry: 1tp8 (more details), 3 Å
SCOPe Domain Sequences for d1tp8.3:
Sequence; same for both SEQRES and ATOM records: (download)
>g1tp8.3 b.77.3.1 (F:,E:) Jacalin {Artocarpus hirsuta [TaxId: 291940]} sgksqtvivgpwgakvXgkafddgaftgireinlsynketaigdfqvvydlngspyvgqn hssfisgftpvkisldfpseyitevsgytgnvsgyvvvrsltfktnkktygpygvtsgtp fnlpienglivgfkgsigywmdyfsmylsl
Timeline for d1tp8.3: