SCOP 1.71: Domain d1tp8.1: 1tp8 B:,A:

Lineage for d1tp8.1 (1tp8 B:,A:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.77: beta-Prism I [51091] (3 superfamilies)
   consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.77.3: Mannose-binding lectins [51101] (1 family)

5. Family b.77.3.1: Mannose-binding lectins [51102] (5 proteins)

6. Protein Jacalin [51103] (2 species)

7. Species Artocarpus hirsuta [TaxId:291940] [110308] (2 PDB entries)

8. Domain d1tp8.1: 1tp8 B:,A: [107185]

Details for d1tp8.1

PDB Entry: 1tp8, 3 Å

PDB Description: crystal structure of a galactose specific lectin from artocarpus hirsuta in complex with methyl-a-d-galactose

SCOP Domain Sequences for d1tp8.1:

Sequence; same for both SEQRES and ATOM records:

>g1tp8.1 b.77.3.1 (B:,A:) Jacalin {Artocarpus hirsuta}
sgksqtvivgpwgakvXgkafddgaftgireinlsynketaigdfqvvydlngspyvgqn
hssfisgftpvkisldfpseyitevsgytgnvsgyvvvrsltfktnkktygpygvtsgtp
fnlpienglivgfkgsigywmdyfsmylsl

Timeline for d1tp8.1:

• d1tp8.1 first appeared in SCOP 1.69
  
• d1tp8.1 appears in SCOP 1.73
  
• d1tp8.1 appears in the current release, SCOPe 2.08