Class b: All beta proteins [48724] (149 folds) |
Fold b.77: beta-Prism I [51091] (3 superfamilies) consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis duplication: has internal pseudo threefold symmetry |
Superfamily b.77.3: Mannose-binding lectins [51101] (1 family) |
Family b.77.3.1: Mannose-binding lectins [51102] (5 proteins) |
Protein Jacalin [51103] (2 species) |
Species Artocarpus hirsuta [TaxId:291940] [110308] (2 PDB entries) |
Domain d1tp8.1: 1tp8 B:,A: [107185] |
PDB Entry: 1tp8 (more details), 3 Å
SCOP Domain Sequences for d1tp8.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1tp8.1 b.77.3.1 (B:,A:) Jacalin {Artocarpus hirsuta} sgksqtvivgpwgakvXgkafddgaftgireinlsynketaigdfqvvydlngspyvgqn hssfisgftpvkisldfpseyitevsgytgnvsgyvvvrsltfktnkktygpygvtsgtp fnlpienglivgfkgsigywmdyfsmylsl
Timeline for d1tp8.1: