SCOP 1.71: Domain d1tp2b_: 1tp2 B:

Lineage for d1tp2b_ (1tp2 B:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)

6. Protein Snake phospholipase A2 [48624] (35 species)

7. Species Snake (Daboia russelli pulchella), different isoforms [48630] (26 PDB entries)

8. Domain d1tp2b_: 1tp2 B: [107182]
   complexed with acy, so4, tda

Details for d1tp2b_

PDB Entry: 1tp2, 2.4 Å

PDB Description: Crystal structure of the complex of group II phospholipaseA2 dimer with a fatty acid tridecanoic acid at 2.4 A resolution

SCOP Domain Sequences for d1tp2b_:

Sequence; same for both SEQRES and ATOM records:

>d1tp2b_ a.133.1.2 (B:) Snake phospholipase A2 {Snake (Daboia russelli pulchella), different isoforms}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

Timeline for d1tp2b_:

• d1tp2b_ first appeared in SCOP 1.69
  
• d1tp2b_ appears in SCOP 1.73
  
• d1tp2b_ appears in the current release, SCOPe 2.08