Lineage for d1tp2b_ (1tp2 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011697Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2011698Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2011703Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 protein domains)
    automatically mapped to Pfam PF00068
  6. 2011813Protein Snake phospholipase A2 [48624] (37 species)
  7. 2012007Species Snake (Daboia russellii pulchella), different isoforms [TaxId:97228] [48630] (38 PDB entries)
    Uniprot P59071
  8. 2012049Domain d1tp2b_: 1tp2 B: [107182]
    complexed with acy, so4, tda

Details for d1tp2b_

PDB Entry: 1tp2 (more details), 2.4 Å

PDB Description: Crystal structure of the complex of group II phospholipaseA2 dimer with a fatty acid tridecanoic acid at 2.4 A resolution
PDB Compounds: (B:) Phospholipase A2 VRV-PL-VIIIa

SCOPe Domain Sequences for d1tp2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tp2b_ a.133.1.2 (B:) Snake phospholipase A2 {Snake (Daboia russellii pulchella), different isoforms [TaxId: 97228]}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

SCOPe Domain Coordinates for d1tp2b_:

Click to download the PDB-style file with coordinates for d1tp2b_.
(The format of our PDB-style files is described here.)

Timeline for d1tp2b_: