Lineage for d1tp2b_ (1tp2 B:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. Protein Snake phospholipase A2 [48624] (38 species)
  7. Species Snake (Daboia russellii pulchella), different isoforms [TaxId:97228] [48630] (39 PDB entries)
    Uniprot P59071
  8. Domain d1tp2b_: 1tp2 B: [107182]
    complexed with acy, so4, tda

Details for d1tp2b_

PDB Entry: 1tp2 (more details), 2.4 Å

PDB Description: Crystal structure of the complex of group II phospholipaseA2 dimer with a fatty acid tridecanoic acid at 2.4 A resolution
PDB Compounds: (B:) Phospholipase A2 VRV-PL-VIIIa

SCOPe Domain Sequences for d1tp2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tp2b_ a.133.1.2 (B:) Snake phospholipase A2 {Snake (Daboia russellii pulchella), different isoforms [TaxId: 97228]}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

SCOPe Domain Coordinates for d1tp2b_ are not available.

Timeline for d1tp2b_:

Domains from other chains:
(mouse over for more information)
d1tp2a_