![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
![]() | Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) ![]() |
![]() | Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) automatically mapped to Pfam PF00068 |
![]() | Protein Snake phospholipase A2 [48624] (38 species) |
![]() | Species Snake (Daboia russellii pulchella), different isoforms [TaxId:97228] [48630] (39 PDB entries) Uniprot P59071 |
![]() | Domain d1tp2a_: 1tp2 A: [107181] complexed with acy, so4, tda |
PDB Entry: 1tp2 (more details), 2.4 Å
SCOPe Domain Sequences for d1tp2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tp2a_ a.133.1.2 (A:) Snake phospholipase A2 {Snake (Daboia russellii pulchella), different isoforms [TaxId: 97228]} sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk c
Timeline for d1tp2a_: