Lineage for d1towa_ (1tow A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 467811Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 467812Superfamily b.60.1: Lipocalins [50814] (5 families) (S)
    bind hydrophobic ligands in their interior
  5. 468030Family b.60.1.2: Fatty acid binding protein-like [50847] (16 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 468031Protein Adipocyte lipid-binding protein, ALBP [50856] (2 species)
  7. 468032Species Human (Homo sapiens) [TaxId:9606] [110275] (2 PDB entries)
  8. 468033Domain d1towa_: 1tow A: [107180]

Details for d1towa_

PDB Entry: 1tow (more details), 2 Å

PDB Description: Crystal structure of human adipocyte fatty acid binding protein in complex with a carboxylic acid ligand

SCOP Domain Sequences for d1towa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1towa_ b.60.1.2 (A:) Adipocyte lipid-binding protein, ALBP {Human (Homo sapiens)}
cdafvgtwklvssenfddymkevgvgfatrkvagmakpnmiisvngdvitiksestfknt
eisfilgqefdevtaddrkvkstitldggvlvhvqkwdgksttikrkreddklvvecvmk
gvtstrvyera

SCOP Domain Coordinates for d1towa_:

Click to download the PDB-style file with coordinates for d1towa_.
(The format of our PDB-style files is described here.)

Timeline for d1towa_: