Class b: All beta proteins [48724] (180 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.10: Cap-Gly domain [74924] (2 families) |
Family b.34.10.1: Cap-Gly domain [74925] (11 proteins) Pfam PF01302 |
Protein Cytoskeleton-associated protein F53F4.3 [74926] (1 species) |
Species Nematode (Caenorhabditis elegans) [TaxId:6239] [74927] (2 PDB entries) Uniprot Q20728 132-229 |
Domain d1tova_: 1tov A: [107179] Structural genomics target complexed with so4 |
PDB Entry: 1tov (more details), 1.77 Å
SCOPe Domain Sequences for d1tova_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tova_ b.34.10.1 (A:) Cytoskeleton-associated protein F53F4.3 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} enesdklneeaaknimvgnrcevtvgaqmarrgevayvgatkfkegvwvgvkydepvgkn dgsvagvryfdcdpkyggfvrpvdvkvgdfpelsidei
Timeline for d1tova_: