SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1toua_ (1tou A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2062521Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2062522Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2063049Family b.60.1.2: Fatty acid binding protein-like [50847] (18 protein domains)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2063050Protein Adipocyte lipid-binding protein, ALBP [50856] (2 species)
  7. 2063051Species Human (Homo sapiens) [TaxId:9606] [110275] (17 PDB entries)
    Uniprot P15090
  8. 2063065Domain d1toua_: 1tou A: [107178]
    complexed with b1v

Details for d1toua_

PDB Entry: 1tou (more details), 2 Å

PDB Description: Crystal structure of human adipocyte fatty acid binding protein in complex with a non-covalent ligand
PDB Compounds: (A:) Fatty acid-binding protein, adipocyte

SCOPe Domain Sequences for d1toua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1toua_ b.60.1.2 (A:) Adipocyte lipid-binding protein, ALBP {Human (Homo sapiens) [TaxId: 9606]}
cdafvgtwklvssenfddymkevgvgfatrkvagmakpnmiisvngdvitiksestfknt
eisfilgqefdevtaddrkvkstitldggvlvhvqkwdgksttikrkreddklvvecvmk
gvtstrvyera

SCOPe Domain Coordinates for d1toua_:

Click to download the PDB-style file with coordinates for d1toua_.
(The format of our PDB-style files is described here.)

Timeline for d1toua_: