Lineage for d1toq.3 (1toq F:,E:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2079052Fold b.77: beta-Prism I [51091] (3 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 2079092Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) (S)
  5. 2079093Family b.77.3.1: Mannose-binding lectins [51102] (7 proteins)
  6. 2079157Protein Jacalin [51103] (2 species)
  7. 2079158Species Artocarpus hirsuta [TaxId:291940] [110308] (2 PDB entries)
    Uniprot Q38723 64-217 95% sequence identity
  8. 2079161Domain d1toq.3: 1toq F:,E: [107176]
    complexed with amg

Details for d1toq.3

PDB Entry: 1toq (more details), 2.5 Å

PDB Description: crystal structure of a galactose specific lectin from artocarpus hirsuta in complex with methyl-a-d-galactose
PDB Compounds: (E:) agglutinin alpha chain, (F:) agglutinin beta chain

SCOPe Domain Sequences for d1toq.3:

Sequence; same for both SEQRES and ATOM records: (download)

>g1toq.3 b.77.3.1 (F:,E:) Jacalin {Artocarpus hirsuta [TaxId: 291940]}
sgksqtvivgpwgakXgkafddgaftgireinlsynketaigdfqvvydlngspyvgqnh
ssfisgftpvkisldfpseyitevsgytgnvsgyvvvrsltfktnkktygpygvtsgtpf
nlpienglivgfkgsigywmdyfsmylsl

SCOPe Domain Coordinates for d1toq.3:

Click to download the PDB-style file with coordinates for d1toq.3.
(The format of our PDB-style files is described here.)

Timeline for d1toq.3: