SCOP 1.71: Domain d1toq.3: 1toq F:,E:

Lineage for d1toq.3 (1toq F:,E:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.77: beta-Prism I [51091] (3 superfamilies)
   consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.77.3: Mannose-binding lectins [51101] (1 family)

5. Family b.77.3.1: Mannose-binding lectins [51102] (5 proteins)

6. Protein Jacalin [51103] (2 species)

7. Species Artocarpus hirsuta [TaxId:291940] [110308] (2 PDB entries)

8. Domain d1toq.3: 1toq F:,E: [107176]

Details for d1toq.3

PDB Entry: 1toq, 2.5 Å

PDB Description: crystal structure of a galactose specific lectin from artocarpus hirsuta in complex with methyl-a-d-galactose

SCOP Domain Sequences for d1toq.3:

Sequence; same for both SEQRES and ATOM records:

>g1toq.3 b.77.3.1 (F:,E:) Jacalin {Artocarpus hirsuta}
sgksqtvivgpwgakXgkafddgaftgireinlsynketaigdfqvvydlngspyvgqnh
ssfisgftpvkisldfpseyitevsgytgnvsgyvvvrsltfktnkktygpygvtsgtpf
nlpienglivgfkgsigywmdyfsmylsl

Timeline for d1toq.3:

• d1toq.3 first appeared in SCOP 1.69
  
• d1toq.3 appears in SCOP 1.73
  
• d1toq.3 appears in the current release, SCOPe 2.08