Lineage for d1to9b1 (1to9 B:1-221)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2015324Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 2015325Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 2015483Family a.132.1.3: TENA/THI-4 [101458] (9 proteins)
    Pfam PF03070; HO-related family lacking the heme-binding site
  6. 2015522Protein Transcriptional activator TenA [110030] (1 species)
  7. 2015523Species Bacillus subtilis [TaxId:1423] [110031] (5 PDB entries)
    Uniprot P25052
  8. 2015539Domain d1to9b1: 1to9 B:1-221 [107173]
    Other proteins in same PDB: d1to9b2
    complexed with hmh

Details for d1to9b1

PDB Entry: 1to9 (more details), 2.4 Å

PDB Description: Crystal structure of THI-4 protein from Bacillus subtilis
PDB Compounds: (B:) THI-4 protein

SCOPe Domain Sequences for d1to9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1to9b1 a.132.1.3 (B:1-221) Transcriptional activator TenA {Bacillus subtilis [TaxId: 1423]}
mkfseecrsaaaewwegsfvhpfvqgigdgtlpidrfkyyvlqdsyylthfakvqsfgaa
yakdlyttgrmashaqgtyeaemalhrefaelleiseeerkafkpsptaysytshmyrsv
lsgnfaeilaallpcywlyyevgekllhcdpghpiyqkwigtyggdwfrqqveeqinrfd
elaensteevrakmkenfvissyyeyqfwgmayrkegwsds

SCOPe Domain Coordinates for d1to9b1:

Click to download the PDB-style file with coordinates for d1to9b1.
(The format of our PDB-style files is described here.)

Timeline for d1to9b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1to9b2
View in 3D
Domains from other chains:
(mouse over for more information)
d1to9a_