Lineage for d1to9b_ (1to9 B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 544344Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 544345Superfamily a.132.1: Heme oxygenase-like [48613] (4 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 544429Family a.132.1.3: TENA/THI-4 [101458] (4 proteins)
    Pfam 03070; HO-related family lacking the heme-binding site
  6. 544446Protein Transcriptional activator TenA [110030] (1 species)
  7. 544447Species Bacillus subtilis [TaxId:1423] [110031] (2 PDB entries)
  8. 544449Domain d1to9b_: 1to9 B: [107173]
    complexed with hmh

Details for d1to9b_

PDB Entry: 1to9 (more details), 2.4 Å

PDB Description: Crystal structure of THI-4 protein from Bacillus subtilis

SCOP Domain Sequences for d1to9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1to9b_ a.132.1.3 (B:) Transcriptional activator TenA {Bacillus subtilis}
namkfseecrsaaaewwegsfvhpfvqgigdgtlpidrfkyyvlqdsyylthfakvqsfg
aayakdlyttgrmashaqgtyeaemalhrefaelleiseeerkafkpsptaysytshmyr
svlsgnfaeilaallpcywlyyevgekllhcdpghpiyqkwigtyggdwfrqqveeqinr
fdelaensteevrakmkenfvissyyeyqfwgmayrkegwsds

SCOP Domain Coordinates for d1to9b_:

Click to download the PDB-style file with coordinates for d1to9b_.
(The format of our PDB-style files is described here.)

Timeline for d1to9b_: