SCOP 1.69: Domain d1to9b_: 1to9 B:

Lineage for d1to9b_ (1to9 B:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (4 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.3: TENA/THI-4 [101458] (4 proteins)
   Pfam 03070; HO-related family lacking the heme-binding site

6. Protein Transcriptional activator TenA [110030] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [110031] (2 PDB entries)

8. Domain d1to9b_: 1to9 B: [107173]

Details for d1to9b_

PDB Entry: 1to9, 2.4 Å

PDB Description: Crystal structure of THI-4 protein from Bacillus subtilis

SCOP Domain Sequences for d1to9b_:

Sequence; same for both SEQRES and ATOM records:

>d1to9b_ a.132.1.3 (B:) Transcriptional activator TenA {Bacillus subtilis}
namkfseecrsaaaewwegsfvhpfvqgigdgtlpidrfkyyvlqdsyylthfakvqsfg
aayakdlyttgrmashaqgtyeaemalhrefaelleiseeerkafkpsptaysytshmyr
svlsgnfaeilaallpcywlyyevgekllhcdpghpiyqkwigtyggdwfrqqveeqinr
fdelaensteevrakmkenfvissyyeyqfwgmayrkegwsds

Timeline for d1to9b_:

• d1to9b_ is new in SCOP 1.69
  
• d1to9b_ appears in SCOP 1.71
  
• d1to9b_ appears in the current release, SCOPe 2.08, called d1to9b1