SCOPe 2.08: Domain d1to9b1: 1to9 B:1-221

Lineage for d1to9b1 (1to9 B:1-221)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.3: TENA/THI-4 [101458] (9 proteins)
   Pfam PF03070; HO-related family lacking the heme-binding site

6. Protein Transcriptional activator TenA [110030] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [110031] (5 PDB entries)
   Uniprot P25052

8. Domain d1to9b1: 1to9 B:1-221 [107173]
   Other proteins in same PDB: d1to9b2
   complexed with hmh

Details for d1to9b1

PDB Entry: 1to9, 2.4 Å

PDB Description: Crystal structure of THI-4 protein from Bacillus subtilis

PDB Compounds: (B:) THI-4 protein

SCOPe Domain Sequences for d1to9b1:

Sequence; same for both SEQRES and ATOM records:

>d1to9b1 a.132.1.3 (B:1-221) Transcriptional activator TenA {Bacillus subtilis [TaxId: 1423]}
mkfseecrsaaaewwegsfvhpfvqgigdgtlpidrfkyyvlqdsyylthfakvqsfgaa
yakdlyttgrmashaqgtyeaemalhrefaelleiseeerkafkpsptaysytshmyrsv
lsgnfaeilaallpcywlyyevgekllhcdpghpiyqkwigtyggdwfrqqveeqinrfd
elaensteevrakmkenfvissyyeyqfwgmayrkegwsds

Timeline for d1to9b1:

• d1to9b1 first appeared in SCOP 1.69, called d1to9b_
  
• d1to9b1 appears in SCOPe 2.07