| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.132: Heme oxygenase-like [48612] (1 superfamily) multihelical; bundle |
Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) ![]() duplication: contains two structural repeats of 3-helical motif |
| Family a.132.1.3: TENA/THI-4 [101458] (9 proteins) Pfam PF03070; HO-related family lacking the heme-binding site |
| Protein Transcriptional activator TenA [110030] (1 species) |
| Species Bacillus subtilis [TaxId:1423] [110031] (5 PDB entries) Uniprot P25052 |
| Domain d1to9a_: 1to9 A: [107172] complexed with hmh |
PDB Entry: 1to9 (more details), 2.4 Å
SCOPe Domain Sequences for d1to9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1to9a_ a.132.1.3 (A:) Transcriptional activator TenA {Bacillus subtilis [TaxId: 1423]}
kfseecrsaaaewwegsfvhpfvqgigdgtlpidrfkyyvlqdsyylthfakvqsfgaay
akdlyttgrmashaqgtyeaemalhrefaelleiseeerkafkpsptaysytshmyrsvl
sgnfaeilaallpcywlyyevgekllhcdpghpiyqkwigtyggdwfrqqveeqinrfde
laensteevrakmkenfvissyyeyqfwgmayrkegwsdsaikev
Timeline for d1to9a_: