Lineage for d1to9a_ (1to9 A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 925023Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 925024Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 925151Family a.132.1.3: TENA/THI-4 [101458] (9 proteins)
    Pfam PF03070; HO-related family lacking the heme-binding site
  6. 925188Protein Transcriptional activator TenA [110030] (1 species)
  7. 925189Species Bacillus subtilis [TaxId:1423] [110031] (4 PDB entries)
    Uniprot P25052
  8. 925190Domain d1to9a_: 1to9 A: [107172]
    complexed with hmh

Details for d1to9a_

PDB Entry: 1to9 (more details), 2.4 Å

PDB Description: Crystal structure of THI-4 protein from Bacillus subtilis
PDB Compounds: (A:) THI-4 protein

SCOPe Domain Sequences for d1to9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1to9a_ a.132.1.3 (A:) Transcriptional activator TenA {Bacillus subtilis [TaxId: 1423]}
kfseecrsaaaewwegsfvhpfvqgigdgtlpidrfkyyvlqdsyylthfakvqsfgaay
akdlyttgrmashaqgtyeaemalhrefaelleiseeerkafkpsptaysytshmyrsvl
sgnfaeilaallpcywlyyevgekllhcdpghpiyqkwigtyggdwfrqqveeqinrfde
laensteevrakmkenfvissyyeyqfwgmayrkegwsdsaikev

SCOPe Domain Coordinates for d1to9a_:

Click to download the PDB-style file with coordinates for d1to9a_.
(The format of our PDB-style files is described here.)

Timeline for d1to9a_: