Class a: All alpha proteins [46456] (226 folds) |
Fold a.132: Heme oxygenase-like [48612] (1 superfamily) multihelical; bundle |
Superfamily a.132.1: Heme oxygenase-like [48613] (4 families) duplication: contains two structural repeats of 3-helical motif |
Family a.132.1.3: TENA/THI-4 [101458] (4 proteins) Pfam 03070; HO-related family lacking the heme-binding site |
Protein Transcriptional activator TenA [110030] (1 species) |
Species Bacillus subtilis [TaxId:1423] [110031] (2 PDB entries) |
Domain d1to9a_: 1to9 A: [107172] |
PDB Entry: 1to9 (more details), 2.4 Å
SCOP Domain Sequences for d1to9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1to9a_ a.132.1.3 (A:) Transcriptional activator TenA {Bacillus subtilis} kfseecrsaaaewwegsfvhpfvqgigdgtlpidrfkyyvlqdsyylthfakvqsfgaay akdlyttgrmashaqgtyeaemalhrefaelleiseeerkafkpsptaysytshmyrsvl sgnfaeilaallpcywlyyevgekllhcdpghpiyqkwigtyggdwfrqqveeqinrfde laensteevrakmkenfvissyyeyqfwgmayrkegwsdsaikev
Timeline for d1to9a_: