Lineage for d1to6b_ (1to6 B:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 496769Fold c.141: Glycerate kinase I (Pfam 02595) [110737] (1 superfamily)
    consists of two different alpha/beta domains; (1) of the Flavodoxin-like fold (scop_cf 52171); (2) similar to the Restriction endonuclease-like fold (scop_cf 52979), inserted into domain 1
  4. 496770Superfamily c.141.1: Glycerate kinase I (Pfam 02595) [110738] (1 family) (S)
  5. 496771Family c.141.1.1: Glycerate kinase I (Pfam 02595) [110739] (1 protein)
  6. 496772Protein Glycerate kinase GlxK [110740] (1 species)
  7. 496773Species Neisseria meningitidis, (serogroup A) [TaxId:487] [110741] (1 PDB entry)
  8. 496775Domain d1to6b_: 1to6 B: [107171]
    Structural genomics target

Details for d1to6b_

PDB Entry: 1to6 (more details), 2.5 Å

PDB Description: glycerate kinase from neisseria meningitidis (serogroup a)

SCOP Domain Sequences for d1to6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1to6b_ c.141.1.1 (B:) Glycerate kinase GlxK {Neisseria meningitidis, (serogroup A)}
mkiviapdsfkesltaqqvaeaikrgfqqsiadvecllcpvgdggegtvdairhsldlee
kclqvtgsfgqkevmryfqkeqlalfevadlvglgkiplekrnplqiqtrgigelirhli
sqeikeiyigvggtasndggigiaaglgyqfydedgnalpacgqsllnlasvstenryki
pedvhiriladvvsplcghqgatytfgkqkgldstmfevvdqaiqdfyekvspatlklkg
agagggiagglcafaqasivsgidtcldlidfdkkvsdvdlvivgegrldrqslagkapi
gvakrtpvgvpvvaicgslvedlpslpfeniqaafsileksepledslknaslylehtas
nighllnmpki

SCOP Domain Coordinates for d1to6b_:

Click to download the PDB-style file with coordinates for d1to6b_.
(The format of our PDB-style files is described here.)

Timeline for d1to6b_: