SCOP 1.75: Domain d1to5c_: 1to5 C:

Lineage for d1to5c_ (1to5 C:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins)

6. Protein Cu,Zn superoxide dismutase, SOD [49331] (11 species)

7. Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [110066] (2 PDB entries)
   Uniprot Q01137

8. Domain d1to5c_: 1to5 C: [107168]

Details for d1to5c_

PDB Entry: 1to5, 2.2 Å

PDB Description: Structure of the cytosolic Cu,Zn SOD from S. mansoni

PDB Compounds: (C:) superoxide dismutase

SCOP Domain Sequences for d1to5c_:

Sequence; same for both SEQRES and ATOM records:

>d1to5c_ b.1.8.1 (C:) Cu,Zn superoxide dismutase, SOD {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
gsnmkavcvmtgtagvkgvvkftqetdngpvhvhaefsglkagkhgfhvhefgdttngct
sagahfnptkqehgapedsirhvgdlgnvvagadgnavynatdklislngshsiigrsmv
iheneddlgrgghelskvtgnaggrlacgvvglaae

Timeline for d1to5c_:

• d1to5c_ first appeared in SCOP 1.69
  
• d1to5c_ appears in SCOP 1.73
  
• d1to5c_ appears in SCOPe 2.01
  
• d1to5c_ appears in the current release, SCOPe 2.08, called d1to5c1