Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) has additional strand at N-terminus |
Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins) |
Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species) |
Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [110066] (2 PDB entries) Uniprot Q01137 |
Domain d1to5c1: 1to5 C:1-153 [107168] Other proteins in same PDB: d1to5a2, d1to5b2, d1to5c2, d1to5d2 complexed with act, cu, zn |
PDB Entry: 1to5 (more details), 2.2 Å
SCOPe Domain Sequences for d1to5c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1to5c1 b.1.8.1 (C:1-153) Cu,Zn superoxide dismutase, SOD {Blood fluke (Schistosoma mansoni) [TaxId: 6183]} mkavcvmtgtagvkgvvkftqetdngpvhvhaefsglkagkhgfhvhefgdttngctsag ahfnptkqehgapedsirhvgdlgnvvagadgnavynatdklislngshsiigrsmvihe neddlgrgghelskvtgnaggrlacgvvglaae
Timeline for d1to5c1: