SCOP 1.71: Domain d1to5b_: 1to5 B:

Lineage for d1to5b_ (1to5 B:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins)

6. Protein Cu,Zn superoxide dismutase, SOD [49331] (11 species)

7. Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [110066] (2 PDB entries)

8. Domain d1to5b_: 1to5 B: [107167]

Details for d1to5b_

PDB Entry: 1to5, 2.2 Å

PDB Description: Structure of the cytosolic Cu,Zn SOD from S. mansoni

SCOP Domain Sequences for d1to5b_:

Sequence; same for both SEQRES and ATOM records:

>d1to5b_ b.1.8.1 (B:) Cu,Zn superoxide dismutase, SOD {Blood fluke (Schistosoma mansoni)}
gsnmkavcvmtgtagvkgvvkftqetdngpvhvhaefsglkagkhgfhvhefgdttngct
sagahfnptkqehgapedsirhvgdlgnvvagadgnavynatdklislngshsiigrsmv
iheneddlgrgghelskvtgnaggrlacgvvglaae

Timeline for d1to5b_:

• d1to5b_ first appeared in SCOP 1.69
  
• d1to5b_ appears in SCOP 1.73
  
• d1to5b_ appears in the current release, SCOPe 2.08, called d1to5b1