Lineage for d1to4b_ (1to4 B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1769113Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 1769114Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. 1769127Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)
  7. 1769156Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [110066] (2 PDB entries)
    Uniprot Q01137
  8. 1769158Domain d1to4b_: 1to4 B: [107163]
    complexed with cu, zn

Details for d1to4b_

PDB Entry: 1to4 (more details), 1.55 Å

PDB Description: Structure of the cytosolic Cu,Zn SOD from S. mansoni
PDB Compounds: (B:) superoxide dismutase

SCOPe Domain Sequences for d1to4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1to4b_ b.1.8.1 (B:) Cu,Zn superoxide dismutase, SOD {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
gsnmkavcvmtgtagvkgvvkftqetdngpvhvhaefsglkagkhgfhvhefgdttngct
sagahfnptkqehgapedsirhvgdlgnvvagadgnavynatdklislngshsiigrsmv
iheneddlgrgghelskvtgnaggrlacgvvglaae

SCOPe Domain Coordinates for d1to4b_:

Click to download the PDB-style file with coordinates for d1to4b_.
(The format of our PDB-style files is described here.)

Timeline for d1to4b_: