| Class b: All beta proteins [48724] (176 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) ![]() has additional strand at N-terminus |
| Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins) |
| Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species) |
| Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [110066] (2 PDB entries) Uniprot Q01137 |
| Domain d1to4a_: 1to4 A: [107162] complexed with cu, zn |
PDB Entry: 1to4 (more details), 1.55 Å
SCOPe Domain Sequences for d1to4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1to4a_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
gsnmkavcvmtgtagvkgvvkftqetdngpvhvhaefsglkagkhgfhvhefgdttngct
sagahfnptkqehgapedsirhvgdlgnvvagadgnavynatdklislngshsiigrsmv
iheneddlgrgghelskvtgnaggrlacgvvglaae
Timeline for d1to4a_: