![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) ![]() has additional strand at N-terminus |
![]() | Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins) |
![]() | Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species) |
![]() | Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [110066] (2 PDB entries) Uniprot Q01137 |
![]() | Domain d1to4a_: 1to4 A: [107162] complexed with cu, zn |
PDB Entry: 1to4 (more details), 1.55 Å
SCOPe Domain Sequences for d1to4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1to4a_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Blood fluke (Schistosoma mansoni) [TaxId: 6183]} gsnmkavcvmtgtagvkgvvkftqetdngpvhvhaefsglkagkhgfhvhefgdttngct sagahfnptkqehgapedsirhvgdlgnvvagadgnavynatdklislngshsiigrsmv iheneddlgrgghelskvtgnaggrlacgvvglaae
Timeline for d1to4a_: