SCOP 1.69: Domain d1to3a_: 1to3 A:

Lineage for d1to3a_ (1to3 A:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (6 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (12 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein Putative aldolase YihT [110358] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [110359] (1 PDB entry)

8. Domain d1to3a_: 1to3 A: [107161]
   Structural genomics target

Details for d1to3a_

PDB Entry: 1to3, 2.7 Å

PDB Description: structure of yiht from salmonella typhimurium

SCOP Domain Sequences for d1to3a_:

Sequence; same for both SEQRES and ATOM records:

>d1to3a_ c.1.10.1 (A:) Putative aldolase YihT {Salmonella typhimurium}
lnnytikditrasggfamlavdqreamrlmfaaagaktpvadsvltdfkvnaakilspya
savlldqqfcyrqaveqnavakscamivaaddfipgngipvdnvvldkkinaqavkrdga
kalkllvlwrsdedaqqrlnmvkefnelchsngllsiiepvvrpprcgdkfdreqaiida
akelgdsgadlykvemplygkgarsdlltasqrlnghinmpwvilssgvdeklfpravrv
ameagasgflagravwssviglpdtelmlrdvsapklqrlgeivdemmgkr

Timeline for d1to3a_:

• d1to3a_ is new in SCOP 1.69
  
• d1to3a_ appears in SCOP 1.71
  
• d1to3a_ appears in the current release, SCOPe 2.08, called d1to3a1