![]() | Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.10: Aldolase [51569] (6 families) ![]() Common fold covers whole protein structure |
![]() | Family c.1.10.1: Class I aldolase [51570] (12 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
![]() | Protein Putative aldolase YihT [110358] (1 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [110359] (1 PDB entry) |
![]() | Domain d1to3a_: 1to3 A: [107161] Structural genomics target |
PDB Entry: 1to3 (more details), 2.7 Å
SCOP Domain Sequences for d1to3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1to3a_ c.1.10.1 (A:) Putative aldolase YihT {Salmonella typhimurium} lnnytikditrasggfamlavdqreamrlmfaaagaktpvadsvltdfkvnaakilspya savlldqqfcyrqaveqnavakscamivaaddfipgngipvdnvvldkkinaqavkrdga kalkllvlwrsdedaqqrlnmvkefnelchsngllsiiepvvrpprcgdkfdreqaiida akelgdsgadlykvemplygkgarsdlltasqrlnghinmpwvilssgvdeklfpravrv ameagasgflagravwssviglpdtelmlrdvsapklqrlgeivdemmgkr
Timeline for d1to3a_: