Lineage for d1to3a1 (1to3 A:2-291)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2834403Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2834927Protein Putative aldolase YihT [110358] (1 species)
  7. 2834928Species Salmonella typhimurium [TaxId:90371] [110359] (1 PDB entry)
    Uniprot Q9L7R9
  8. 2834929Domain d1to3a1: 1to3 A:2-291 [107161]
    Other proteins in same PDB: d1to3a2
    Structural genomics target
    complexed with br, po4

Details for d1to3a1

PDB Entry: 1to3 (more details), 2.7 Å

PDB Description: structure of yiht from salmonella typhimurium
PDB Compounds: (A:) Putative aldolase yihT

SCOPe Domain Sequences for d1to3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1to3a1 c.1.10.1 (A:2-291) Putative aldolase YihT {Salmonella typhimurium [TaxId: 90371]}
nnytikditrasggfamlavdqreamrlmfaaagaktpvadsvltdfkvnaakilspyas
avlldqqfcyrqaveqnavakscamivaaddfipgngipvdnvvldkkinaqavkrdgak
alkllvlwrsdedaqqrlnmvkefnelchsngllsiiepvvrpprcgdkfdreqaiidaa
kelgdsgadlykvemplygkgarsdlltasqrlnghinmpwvilssgvdeklfpravrva
meagasgflagravwssviglpdtelmlrdvsapklqrlgeivdemmgkr

SCOPe Domain Coordinates for d1to3a1:

Click to download the PDB-style file with coordinates for d1to3a1.
(The format of our PDB-style files is described here.)

Timeline for d1to3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1to3a2