SCOPe 2.08: Domain d1to3a1: 1to3 A:2-291

Lineage for d1to3a1 (1to3 A:2-291)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (13 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein Putative aldolase YihT [110358] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [110359] (1 PDB entry)
   Uniprot Q9L7R9

8. Domain d1to3a1: 1to3 A:2-291 [107161]
   Other proteins in same PDB: d1to3a2
   Structural genomics target
   complexed with br, po4

Details for d1to3a1

PDB Entry: 1to3, 2.7 Å

PDB Description: structure of yiht from salmonella typhimurium

PDB Compounds: (A:) Putative aldolase yihT

SCOPe Domain Sequences for d1to3a1:

Sequence; same for both SEQRES and ATOM records:

>d1to3a1 c.1.10.1 (A:2-291) Putative aldolase YihT {Salmonella typhimurium [TaxId: 90371]}
nnytikditrasggfamlavdqreamrlmfaaagaktpvadsvltdfkvnaakilspyas
avlldqqfcyrqaveqnavakscamivaaddfipgngipvdnvvldkkinaqavkrdgak
alkllvlwrsdedaqqrlnmvkefnelchsngllsiiepvvrpprcgdkfdreqaiidaa
kelgdsgadlykvemplygkgarsdlltasqrlnghinmpwvilssgvdeklfpravrva
meagasgflagravwssviglpdtelmlrdvsapklqrlgeivdemmgkr

Timeline for d1to3a1:

• d1to3a1 first appeared in SCOP 1.69, called d1to3a_
  
• d1to3a1 appears in SCOPe 2.07