SCOP 1.69: Domain d1to0h_: 1to0 H:

Lineage for d1to0h_ (1to0 H:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.116: alpha/beta knot [75216] (1 superfamily)
   core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot

4. Superfamily c.116.1: alpha/beta knot [75217] (5 families)
   known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
   all known members have dimeric structures

5. Family c.116.1.3: YbeA-like [82371] (4 proteins)
   Pfam 02590

6. Protein Hypothetical protein YydA [110497] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [110498] (1 PDB entry)

8. Domain d1to0h_: 1to0 H: [107160]

Details for d1to0h_

PDB Entry: 1to0, 2.5 Å

PDB Description: X-ray structure of Northeast Structural Genomics target protein sr145 from Bacillus subtilis

SCOP Domain Sequences for d1to0h_:

Sequence, based on SEQRES records:

>d1to0h_ c.116.1.3 (H:) Hypothetical protein YydA {Bacillus subtilis}
mninivtigklkekylkqgieeytkrlsayakidiielpdekapenlsdqdmkiikdkeg
drilskispdahvialaiegkmktseeladtidklatygkskvtfviggslglsdtvmkr
adeklsfskmtfphqlmrlilveqiyrafrinrgepy

Sequence, based on observed residues (ATOM records):

>d1to0h_ c.116.1.3 (H:) Hypothetical protein YydA {Bacillus subtilis}
mninivtigklkekylkqgieeytkrlsayakidiielpdekqdmkiikdkegdrilski
spdahvialaiegkmktseeladtidklatygkskvtfviggslglsdtvmkradeklsf
skmtfphqlmrlilveqiyrafrinrgepy

Timeline for d1to0h_:

• d1to0h_ is new in SCOP 1.69
  
• d1to0h_ appears in SCOP 1.71
  
• d1to0h_ appears in the current release, SCOPe 2.08