Lineage for d1to0c_ (1to0 C:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 594975Fold c.116: alpha/beta knot [75216] (1 superfamily)
    core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot
  4. 594976Superfamily c.116.1: alpha/beta knot [75217] (5 families) (S)
    known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
    all known members have dimeric structures
  5. 595003Family c.116.1.3: YbeA-like [82371] (4 proteins)
    Pfam 02590
  6. 595019Protein Hypothetical protein YydA [110497] (1 species)
  7. 595020Species Bacillus subtilis [TaxId:1423] [110498] (1 PDB entry)
  8. 595023Domain d1to0c_: 1to0 C: [107155]

Details for d1to0c_

PDB Entry: 1to0 (more details), 2.5 Å

PDB Description: X-ray structure of Northeast Structural Genomics target protein sr145 from Bacillus subtilis

SCOP Domain Sequences for d1to0c_:

Sequence, based on SEQRES records: (download)

>d1to0c_ c.116.1.3 (C:) Hypothetical protein YydA {Bacillus subtilis}
mninivtigklkekylkqgieeytkrlsayakidiielpdekapenlsdqdmkiikdkeg
drilskispdahvialaiegkmktseeladtidklatygkskvtfviggslglsdtvmkr
adeklsfskmtfphqlmrlilveqiyrafrinrge

Sequence, based on observed residues (ATOM records): (download)

>d1to0c_ c.116.1.3 (C:) Hypothetical protein YydA {Bacillus subtilis}
mninivtigklkekylkqgieeytkrlsayakidiielpdekqdmkiikdkegdrilski
spdahvialaiegkmktseeladtidklatygkskvtfviggslglsdtvmkradeklsf
skmtfphqlmrlilveqiyrafrinrge

SCOP Domain Coordinates for d1to0c_:

Click to download the PDB-style file with coordinates for d1to0c_.
(The format of our PDB-style files is described here.)

Timeline for d1to0c_: