SCOP 1.69: Domain d1tmib_: 1tmi B:

Lineage for d1tmib_ (1tmi B:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.156: S-adenosylmethionine decarboxylase [56275] (1 superfamily)
   duplication of beta-alpha-beta(4)-alpha-beta-alpha-beta(2) motif; 4 layers a/b/b/a; antiparallel beta-sheets: order 23451687

4. Superfamily d.156.1: S-adenosylmethionine decarboxylase [56276] (2 families)

5. Family d.156.1.2: Bacterial S-adenosylmethionine decarboxylase (Pfam 02675) [111222] (1 protein)
   homodimer; the subunit fold and assembly are similar to those of the structural repeats of the eukaryotic enzyme

6. Protein S-adenosylmethionine decarboxylase (SamDC, SpeH) [111223] (1 species)

7. Species Thermotoga maritima [TaxId:243274] [111224] (2 PDB entries)

8. Domain d1tmib_: 1tmi B: [107152]

Details for d1tmib_

PDB Entry: 1tmi, 1.7 Å

PDB Description: structure of thermotoga maritima s63a non-processing mutant s- adenosylmethionine decarboxylase

SCOP Domain Sequences for d1tmib_:

Sequence; same for both SEQRES and ATOM records:

>d1tmib_ d.156.1.2 (B:) S-adenosylmethionine decarboxylase (SamDC, SpeH) {Thermotoga maritima}
kslgrhlvaefyecdrevldnvqlieqemkqaayesgativtstfhrflpygvsgvvvis
eahltihtwpeygyaaidlftcgedvdpwkafehlkkalkakrvhvvehergrydei

Timeline for d1tmib_:

• d1tmib_ is new in SCOP 1.69
  
• d1tmib_ appears in SCOP 1.71
  
• d1tmib_ appears in the current release, SCOPe 2.08