Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.156: S-adenosylmethionine decarboxylase [56275] (1 superfamily) duplication of beta-alpha-beta(4)-alpha-beta-alpha-beta(2) motif; 4 layers a/b/b/a; antiparallel beta-sheets: order 23451687 |
Superfamily d.156.1: S-adenosylmethionine decarboxylase [56276] (3 families) |
Family d.156.1.2: Bacterial S-adenosylmethionine decarboxylase [111222] (2 proteins) Pfam PF02675;homodimer; the subunit fold and assembly are similar to those of the structural repeats of the eukaryotic enzyme |
Protein S-adenosylmethionine decarboxylase (SamDC, SpeH) [111223] (1 species) |
Species Thermotoga maritima [TaxId:2336] [111224] (2 PDB entries) Uniprot Q9WZC3 |
Domain d1tmia_: 1tmi A: [107151] mutant |
PDB Entry: 1tmi (more details), 1.7 Å
SCOPe Domain Sequences for d1tmia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tmia_ d.156.1.2 (A:) S-adenosylmethionine decarboxylase (SamDC, SpeH) {Thermotoga maritima [TaxId: 2336]} kslgrhlvaefyecdrevldnvqlieqemkqaayesgativtstfhrflpygvsgvvvis eahltihtwpeygyaaidlftcgedvdpwkafehlkkalkakrvhvvehergrydei
Timeline for d1tmia_: