SCOPe 2.07: Domain d1tmia_: 1tmi A:

Lineage for d1tmia_ (1tmi A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.156: S-adenosylmethionine decarboxylase [56275] (1 superfamily)
   duplication of beta-alpha-beta(4)-alpha-beta-alpha-beta(2) motif; 4 layers a/b/b/a; antiparallel beta-sheets: order 23451687

4. Superfamily d.156.1: S-adenosylmethionine decarboxylase [56276] (3 families)

5. Family d.156.1.2: Bacterial S-adenosylmethionine decarboxylase [111222] (2 proteins)
   Pfam PF02675;homodimer; the subunit fold and assembly are similar to those of the structural repeats of the eukaryotic enzyme

6. Protein S-adenosylmethionine decarboxylase (SamDC, SpeH) [111223] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [111224] (2 PDB entries)
   Uniprot Q9WZC3

8. Domain d1tmia_: 1tmi A: [107151]
   mutant

Details for d1tmia_

PDB Entry: 1tmi, 1.7 Å

PDB Description: structure of thermotoga maritima s63a non-processing mutant s- adenosylmethionine decarboxylase

PDB Compounds: (A:) S-adenosylmethionine decarboxylase proenzyme, AdoMetDC, SamDC

SCOPe Domain Sequences for d1tmia_:

Sequence; same for both SEQRES and ATOM records:

>d1tmia_ d.156.1.2 (A:) S-adenosylmethionine decarboxylase (SamDC, SpeH) {Thermotoga maritima [TaxId: 2336]}
kslgrhlvaefyecdrevldnvqlieqemkqaayesgativtstfhrflpygvsgvvvis
eahltihtwpeygyaaidlftcgedvdpwkafehlkkalkakrvhvvehergrydei

Timeline for d1tmia_:

• d1tmia_ first appeared in SCOP 1.69
  
• d1tmia_ appears in SCOPe 2.06
  
• d1tmia_ appears in the current release, SCOPe 2.08