Lineage for d1tm9a_ (1tm9 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2737852Fold a.225: Hypothetical protein MG354 [110008] (1 superfamily)
    multihelical bundle; contains buried central helix
  4. 2737853Superfamily a.225.1: Hypothetical protein MG354 [110009] (1 family) (S)
    automatically mapped to Pfam PF09188
  5. 2737854Family a.225.1.1: Hypothetical protein MG354 [110010] (1 protein)
  6. 2737855Protein Hypothetical protein MG354 [110011] (1 species)
  7. 2737856Species Mycoplasma genitalium [TaxId:2097] [110012] (1 PDB entry)
    Uniprot P47596
  8. 2737857Domain d1tm9a_: 1tm9 A: [107150]
    Structural genomics target

Details for d1tm9a_

PDB Entry: 1tm9 (more details)

PDB Description: nmr structure of gene target number gi3844938 from mycoplasma genitalium: berkeley structural genomics center
PDB Compounds: (A:) Hypothetical protein MG354

SCOPe Domain Sequences for d1tm9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tm9a_ a.225.1.1 (A:) Hypothetical protein MG354 {Mycoplasma genitalium [TaxId: 2097]}
meqnnikeqlisffnqacsthqerldficstresdtfssvdvplepikniieitkdenqq
ieitkiavnniktlssvgatgqymasffstnsepaiifcviyflyhfgflkdnnkkqiik
kayetiadniadylnen

SCOPe Domain Coordinates for d1tm9a_:

Click to download the PDB-style file with coordinates for d1tm9a_.
(The format of our PDB-style files is described here.)

Timeline for d1tm9a_: