![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.225: Hypothetical protein MG354 [110008] (1 superfamily) multihelical bundle; contains buried central helix |
![]() | Superfamily a.225.1: Hypothetical protein MG354 [110009] (1 family) ![]() automatically mapped to Pfam PF09188 |
![]() | Family a.225.1.1: Hypothetical protein MG354 [110010] (1 protein) |
![]() | Protein Hypothetical protein MG354 [110011] (1 species) |
![]() | Species Mycoplasma genitalium [TaxId:2097] [110012] (1 PDB entry) Uniprot P47596 |
![]() | Domain d1tm9a_: 1tm9 A: [107150] Structural genomics target |
PDB Entry: 1tm9 (more details)
SCOPe Domain Sequences for d1tm9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tm9a_ a.225.1.1 (A:) Hypothetical protein MG354 {Mycoplasma genitalium [TaxId: 2097]} meqnnikeqlisffnqacsthqerldficstresdtfssvdvplepikniieitkdenqq ieitkiavnniktlssvgatgqymasffstnsepaiifcviyflyhfgflkdnnkkqiik kayetiadniadylnen
Timeline for d1tm9a_: