Lineage for d1tm2a_ (1tm2 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520303Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2520304Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2520305Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)
  6. 2520306Protein AI-2 receptor LsrB [110745] (1 species)
  7. 2520307Species Salmonella typhi [TaxId:90370] [110746] (2 PDB entries)
    Uniprot Q8Z2X8 27-340
  8. 2520309Domain d1tm2a_: 1tm2 A: [107149]

Details for d1tm2a_

PDB Entry: 1tm2 (more details), 1.9 Å

PDB Description: crystal structure of the apo form of the salmonella typhimurium ai-2 receptor lsrb
PDB Compounds: (A:) sugar transport protein

SCOPe Domain Sequences for d1tm2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tm2a_ c.93.1.1 (A:) AI-2 receptor LsrB {Salmonella typhi [TaxId: 90370]}
aeriafipklvgvgfftsggngaqeagkalgidvtydgptepsvsgqvqlvnnfvnqgyd
aiivsavspdglcpalkramqrgvkiltwdsdtkpecrsyyinqgtpkqlgsmlvemaah
qvdkekakvaffyssptvtdqnqwvkeakakisqehpgweivttqfgyndatkslqtaeg
iikaypdldaiiapdanalpaaaqaaenlkrnnlaivgfstpnvmrpyvqrgtvkefglw
dvvqqgkisvyvanallknmpmnvgdsldipgigkvtvspnseqgyhyeakgngivllpe
rvifnkdnidkydf

SCOPe Domain Coordinates for d1tm2a_:

Click to download the PDB-style file with coordinates for d1tm2a_.
(The format of our PDB-style files is described here.)

Timeline for d1tm2a_: