Lineage for d1tm2a_ (1tm2 A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 494585Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 494586Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 494587Family c.93.1.1: L-arabinose binding protein-like [53823] (14 proteins)
  6. 494588Protein AI-2 receptor LsrB [110745] (1 species)
  7. 494589Species Salmonella typhi [TaxId:90370] [110746] (2 PDB entries)
  8. 494591Domain d1tm2a_: 1tm2 A: [107149]

Details for d1tm2a_

PDB Entry: 1tm2 (more details), 1.9 Å

PDB Description: crystal structure of the apo form of the salmonella typhimurium ai-2 receptor lsrb

SCOP Domain Sequences for d1tm2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tm2a_ c.93.1.1 (A:) AI-2 receptor LsrB {Salmonella typhi}
aeriafipklvgvgfftsggngaqeagkalgidvtydgptepsvsgqvqlvnnfvnqgyd
aiivsavspdglcpalkramqrgvkiltwdsdtkpecrsyyinqgtpkqlgsmlvemaah
qvdkekakvaffyssptvtdqnqwvkeakakisqehpgweivttqfgyndatkslqtaeg
iikaypdldaiiapdanalpaaaqaaenlkrnnlaivgfstpnvmrpyvqrgtvkefglw
dvvqqgkisvyvanallknmpmnvgdsldipgigkvtvspnseqgyhyeakgngivllpe
rvifnkdnidkydf

SCOP Domain Coordinates for d1tm2a_:

Click to download the PDB-style file with coordinates for d1tm2a_.
(The format of our PDB-style files is described here.)

Timeline for d1tm2a_: