Lineage for d1tm0b_ (1tm0 B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2164557Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
    mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix
  4. 2164558Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) (S)
    duplication: consists of two similar domain swapped with C-terminal strands
  5. 2164657Family d.21.1.3: Proline racemase [110863] (2 protein domains)
    Pfam PF05544
  6. 2164658Protein Proline racemase [110864] (1 species)
  7. 2164659Species Brucella melitensis [TaxId:29459] [110865] (1 PDB entry)
    Uniprot Q8YFD6
  8. 2164661Domain d1tm0b_: 1tm0 B: [107148]
    Structural genomics target

Details for d1tm0b_

PDB Entry: 1tm0 (more details), 2.8 Å

PDB Description: crystal structure of the putative proline racemase from brucella melitensis, northeast structural genomics target lr31
PDB Compounds: (B:) proline racemase

SCOPe Domain Sequences for d1tm0b_:

Sequence, based on SEQRES records: (download)

>d1tm0b_ d.21.1.3 (B:) Proline racemase {Brucella melitensis [TaxId: 29459]}
mrstkvihivgchaegevgdvivggvapppgetvweqsrfiandetlrnfvlnkprggvf
rhvnllvppkdpraqmgfiimepadtppmsgsnsicvstvlldsgiiamqepvthmvlea
pggiieveaecrngkaerisvrnvpsfadrldapldvtglgtimvdtayggdsfvivdaa
qigmkiepgqarelaeigvkitkaaneqlgfrhperdwrhisfcqitepvtregdvltgv
ntvairpakfdrsptgtgcsarmavlhakgqmkagerfigksvlgtefhcrldkvlelgg
kpaispiisgrawvtgtsqlmldpsdpfphgy

Sequence, based on observed residues (ATOM records): (download)

>d1tm0b_ d.21.1.3 (B:) Proline racemase {Brucella melitensis [TaxId: 29459]}
mrstkvihivgchaegevgdvivggvapppgetvweqsrfiandetlrnfvlnkprggvf
rhvnllvppkdpraqmgfiimepadtppmsgsnsicvstvlldsgiiamqepvthmvlea
pggiieveaecrngkaerisvrnvpsfadrldapldvtglgtimvdtayggdsfvivdaa
qigepgqarelaeigvkitkafrhperdwrhisfcqitepvtregdvltgvntvptgtgc
sarmavlhakgqmkagerfigksvtefhcrldkvlelggkpaispiisgrawvtgtsqlm
ldpsdpfphgy

SCOPe Domain Coordinates for d1tm0b_:

Click to download the PDB-style file with coordinates for d1tm0b_.
(The format of our PDB-style files is described here.)

Timeline for d1tm0b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1tm0a_