Lineage for d1tm0a_ (1tm0 A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 600808Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
    mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix
  4. 600809Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (3 families) (S)
    duplication: consists of two similar domain swapped with C-terminal strands
  5. 600864Family d.21.1.3: Proline racemase [110863] (1 protein)
    Pfam 05544
  6. 600865Protein Proline racemase [110864] (1 species)
  7. 600866Species Brucella melitensis [110865] (1 PDB entry)
  8. 600867Domain d1tm0a_: 1tm0 A: [107147]

Details for d1tm0a_

PDB Entry: 1tm0 (more details), 2.8 Å

PDB Description: crystal structure of the putative proline racemase from brucella melitensis, northeast structural genomics target lr31

SCOP Domain Sequences for d1tm0a_:

Sequence, based on SEQRES records: (download)

>d1tm0a_ d.21.1.3 (A:) Proline racemase {Brucella melitensis}
mrstkvihivgchaegevgdvivggvapppgetvweqsrfiandetlrnfvlnkprggvf
rhvnllvppkdpraqmgfiimepadtppmsgsnsicvstvlldsgiiamqepvthmvlea
pggiieveaecrngkaerisvrnvpsfadrldapldvtglgtimvdtayggdsfvivdaa
qigmkiepgqarelaeigvkitkaaneqlgfrhperdwrhisfcqitepvtregdvltgv
ntvairpakfdrsptgtgcsarmavlhakgqmkagerfigksvlgtefhcrldkvlelgg
kpaispiisgrawvtgtsqlmldpsdpfphgy

Sequence, based on observed residues (ATOM records): (download)

>d1tm0a_ d.21.1.3 (A:) Proline racemase {Brucella melitensis}
mrstkvihivgchaegevgdvivggvapppgetvweqsrfiandetlrnfvlnkprggvf
rhvnllvppkdpraqmgfiimepadtppmsgsnsicvstvlldsgiiamqepvthmvlea
pggiieveaecrngkaerisvrnvpsfadrldapldvtglgtimvdtayggdsfvivdaa
qigepgqarelaeigvkitkafrhperdwrhisfcqitepvtregdvltgvntvptgtgc
sarmavlhakgqmkagerfigksvtefhcrldkvlelggkpaispiisgrawvtgtsqlm
ldpsdpfphgy

SCOP Domain Coordinates for d1tm0a_:

Click to download the PDB-style file with coordinates for d1tm0a_.
(The format of our PDB-style files is described here.)

Timeline for d1tm0a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1tm0b_