Lineage for d1tlzb_ (1tlz B:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2575768Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 2576161Superfamily f.4.6: Tsx-like channel [111364] (1 family) (S)
    forms (12,16) barrel
    automatically mapped to Pfam PF03502
  5. 2576162Family f.4.6.1: Tsx-like channel [111365] (1 protein)
    Pfam PF03502
  6. 2576163Protein Nucleoside-specific channel-forming protein tsx (NupA) [111366] (1 species)
  7. 2576164Species Escherichia coli [TaxId:562] [111367] (3 PDB entries)
    Uniprot P22786
  8. 2576168Domain d1tlzb_: 1tlz B: [107146]
    Other proteins in same PDB: d1tlza2
    complexed with uri

Details for d1tlzb_

PDB Entry: 1tlz (more details), 3.1 Å

PDB Description: Tsx structure complexed with uridine
PDB Compounds: (B:) Nucleoside-specific channel-forming protein tsx

SCOPe Domain Sequences for d1tlzb_:

Sequence, based on SEQRES records: (download)

>d1tlzb_ f.4.6.1 (B:) Nucleoside-specific channel-forming protein tsx (NupA) {Escherichia coli [TaxId: 562]}
lsdwwhqsvnvvgsyhtrfgpqirndtyleyeafakkdwfdfygyadapvffggnsdakg
iwnhgsplfmeieprfsidkltntdlsfgpfkewyfannyiydmgrnkdgrqstwymglg
tdidtglpmslsmnvyakyqwqnygaanenewdgyrfkikyfvpitdlwggqlsyigftn
fdwgsdlgddsgnaingiktrtnnsiasshilalnydhwhysvvarywhdggqwnddael
nfgngnfnvrstgwggylvvgynf

Sequence, based on observed residues (ATOM records): (download)

>d1tlzb_ f.4.6.1 (B:) Nucleoside-specific channel-forming protein tsx (NupA) {Escherichia coli [TaxId: 562]}
lsdwwhqsvnvvgsyhtrfgpqirndtyleyeafakkdwfdfygyadapvplfmeieprf
sidkltntdlsfgpfkewyfannyiydmgrnkdgrqstwymglgtdidtglpmslsmnvy
akyqwqnygaanenewdgyrfkikyfvpitdlwggqlsyigftnfdwgsdlgddsgnain
giktrtnnsiasshilalnydhwhysvvarywhdggqwnddaelnfgngnfnvrstgwgg
ylvvgynf

SCOPe Domain Coordinates for d1tlzb_:

Click to download the PDB-style file with coordinates for d1tlzb_.
(The format of our PDB-style files is described here.)

Timeline for d1tlzb_: