Lineage for d1tlza_ (1tlz A:)

  1. Root: SCOP 1.69
  2. 519077Class f: Membrane and cell surface proteins and peptides [56835] (47 folds)
  3. 519206Fold f.4: Transmembrane beta-barrels [56924] (6 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 519369Superfamily f.4.6: Tsx-like channel (Pfam 03502) [111364] (1 family) (S)
    forms (12,16) barrel
  5. 519370Family f.4.6.1: Tsx-like channel (Pfam 03502) [111365] (1 protein)
  6. 519371Protein Nucleoside-specific channel-forming protein tsx (NupA) [111366] (1 species)
  7. 519372Species Escherichia coli [TaxId:562] [111367] (3 PDB entries)
  8. 519377Domain d1tlza_: 1tlz A: [107145]

Details for d1tlza_

PDB Entry: 1tlz (more details), 3.1 Å

PDB Description: Tsx structure complexed with uridine

SCOP Domain Sequences for d1tlza_:

Sequence, based on SEQRES records: (download)

>d1tlza_ f.4.6.1 (A:) Nucleoside-specific channel-forming protein tsx (NupA) {Escherichia coli}
lsdwwhqsvnvvgsyhtrfgpqirndtyleyeafakkdwfdfygyadapvffggnsdakg
iwnhgsplfmeieprfsidkltntdlsfgpfkewyfannyiydmgrnkdgrqstwymglg
tdidtglpmslsmnvyakyqwqnygaanenewdgyrfkikyfvpitdlwggqlsyigftn
fdwgsdlgddsgnaingiktrtnnsiasshilalnydhwhysvvarywhdggqwnddael
nfgngnfnvrstgwggylvvgynfhhh

Sequence, based on observed residues (ATOM records): (download)

>d1tlza_ f.4.6.1 (A:) Nucleoside-specific channel-forming protein tsx (NupA) {Escherichia coli}
lsdwwhqsvnvvgsyhtrfgpqirndtyleyeafakkdwfdfygyadapvplfmeieprf
sidkltntdlsfgpfkewyfannyiydmgrnkdgrqstwymglgtdidtglpmslsmnvy
akyqwqnygaanenewdgyrfkikyfvpitdlwggqlsyigftnfdwgsdlgddsgnain
giktrtnnsiasshilalnydhwhysvvarywhdggqwnddaelnfgngnfnvrstgwgg
ylvvgynfhhh

SCOP Domain Coordinates for d1tlza_:

Click to download the PDB-style file with coordinates for d1tlza_.
(The format of our PDB-style files is described here.)

Timeline for d1tlza_: