![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies) not a true fold, gathers together transmembrane barrels of different (n,S) annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.4.6: Tsx-like channel [111364] (1 family) ![]() forms (12,16) barrel automatically mapped to Pfam PF03502 |
![]() | Family f.4.6.1: Tsx-like channel [111365] (1 protein) Pfam PF03502 |
![]() | Protein Nucleoside-specific channel-forming protein tsx (NupA) [111366] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [111367] (3 PDB entries) Uniprot P22786 |
![]() | Domain d1tlya1: 1tly A:9-272 [107143] Other proteins in same PDB: d1tlya2 |
PDB Entry: 1tly (more details), 3.01 Å
SCOPe Domain Sequences for d1tlya1:
Sequence, based on SEQRES records: (download)
>d1tlya1 f.4.6.1 (A:9-272) Nucleoside-specific channel-forming protein tsx (NupA) {Escherichia coli [TaxId: 562]} lsdwwhqsvnvvgsyhtrfgpqirndtyleyeafakkdwfdfygyadapvffggnsdakg iwnhgsplfmeieprfsidkltntdlsfgpfkewyfannyiydmgrnkdgrqstwymglg tdidtglpmslsmnvyakyqwqnygaanenewdgyrfkikyfvpitdlwggqlsyigftn fdwgsdlgddsgnaingiktrtnnsiasshilalnydhwhysvvarywhdggqwnddael nfgngnfnvrstgwggylvvgynf
>d1tlya1 f.4.6.1 (A:9-272) Nucleoside-specific channel-forming protein tsx (NupA) {Escherichia coli [TaxId: 562]} lsdwwhqsvnvvgsyhtrfgpqirndtyleyeafakkdwfdfygyadapvplfmeieprf sidkltntdlsfgpfkewyfannyiydmgrnkdgrqstwymglgtdidtglpmslsmnvy akyqwqnygaanenewdgyrfkikyfvpitdlwggqlsyigftnfdwgsdlgddsgnain giktrtnnsiasshilalnydhwhysvvarywhdggqwnddaelnfgngnfnvrstgwgg ylvvgynf
Timeline for d1tlya1: