Lineage for d1tlwb_ (1tlw B:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021955Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3022455Superfamily f.4.6: Tsx-like channel [111364] (1 family) (S)
    forms (12,16) barrel
    automatically mapped to Pfam PF03502
  5. 3022456Family f.4.6.1: Tsx-like channel [111365] (1 protein)
    Pfam PF03502
  6. 3022457Protein Nucleoside-specific channel-forming protein tsx (NupA) [111366] (1 species)
  7. 3022458Species Escherichia coli [TaxId:562] [111367] (3 PDB entries)
    Uniprot P22786
  8. 3022460Domain d1tlwb_: 1tlw B: [107142]
    Other proteins in same PDB: d1tlwa2
    complexed with thm

Details for d1tlwb_

PDB Entry: 1tlw (more details), 3.1 Å

PDB Description: Tsx structure complexed with thymidine
PDB Compounds: (B:) Nucleoside-specific channel-forming protein tsx

SCOPe Domain Sequences for d1tlwb_:

Sequence, based on SEQRES records: (download)

>d1tlwb_ f.4.6.1 (B:) Nucleoside-specific channel-forming protein tsx (NupA) {Escherichia coli [TaxId: 562]}
lsdwwhqsvnvvgsyhtrfgpqirndtyleyeafakkdwfdfygyadapvffggnsdakg
iwnhgsplfmeieprfsidkltntdlsfgpfkewyfannyiydmgrnkdgrqstwymglg
tdidtglpmslsmnvyakyqwqnygaanenewdgyrfkikyfvpitdlwggqlsyigftn
fdwgsdlgddsgnaingiktrtnnsiasshilalnydhwhysvvarywhdggqwnddael
nfgngnfnvrstgwggylvvgynf

Sequence, based on observed residues (ATOM records): (download)

>d1tlwb_ f.4.6.1 (B:) Nucleoside-specific channel-forming protein tsx (NupA) {Escherichia coli [TaxId: 562]}
lsdwwhqsvnvvgsyhtrfgpqirndtyleyeafakkdwfdfygyadapvplfmeieprf
sidkltntdlsfgpfkewyfannyiydmgrnkdgrqstwymglgtdidtglpmslsmnvy
akyqwqnygaanenewdgyrfkikyfvpitdlwggqlsyigftnfdwgsdlgddsgnain
giktrtnnsiasshilalnydhwhysvvarywhdggqwnddaelnfgngnfnvrstgwgg
ylvvgynf

SCOPe Domain Coordinates for d1tlwb_:

Click to download the PDB-style file with coordinates for d1tlwb_.
(The format of our PDB-style files is described here.)

Timeline for d1tlwb_: