SCOPe 2.08: Domain d1tlub_: 1tlu B:

Lineage for d1tlub_ (1tlu B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.156: S-adenosylmethionine decarboxylase [56275] (1 superfamily)
   duplication of beta-alpha-beta(4)-alpha-beta-alpha-beta(2) motif; 4 layers a/b/b/a; antiparallel beta-sheets: order 23451687

4. Superfamily d.156.1: S-adenosylmethionine decarboxylase [56276] (3 families)

5. Family d.156.1.2: Bacterial S-adenosylmethionine decarboxylase [111222] (2 proteins)
   Pfam PF02675;homodimer; the subunit fold and assembly are similar to those of the structural repeats of the eukaryotic enzyme

6. Protein S-adenosylmethionine decarboxylase (SamDC, SpeH) [111223] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [111224] (2 PDB entries)
   Uniprot Q9WZC3

8. Domain d1tlub_: 1tlu B: [107140]

Details for d1tlub_

PDB Entry: 1tlu, 1.55 Å

PDB Description: Crystal Structure of Thermotoga maritima S-adenosylmethionine decarboxylase

PDB Compounds: (B:) S-adenosylmethionine decarboxylase proenzyme, AdoMetDC, SamDC

SCOPe Domain Sequences for d1tlub_:

Sequence; same for both SEQRES and ATOM records:

>d1tlub_ d.156.1.2 (B:) S-adenosylmethionine decarboxylase (SamDC, SpeH) {Thermotoga maritima [TaxId: 2336]}
kslgrhlvaefyecdrevldnvqlieqemkqaayesgativtstfhrflpygvsgvvvis
eshltihtwpeygyaaidlftcgedvdpwkafehlkkalkakrvhvvehergrydei

Timeline for d1tlub_:

• d1tlub_ first appeared in SCOP 1.69
  
• d1tlub_ appears in SCOPe 2.07