Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) N-terminal domain is the classic Rossmann-fold |
Family d.81.1.5: Glucose 6-phosphate dehydrogenase-like [55376] (7 proteins) has many additional secondary structures |
Protein Virulence factor MviM [111052] (1 species) |
Species Escherichia coli [TaxId:562] [111053] (1 PDB entry) Uniprot P75931 |
Domain d1tltb2: 1tlt B:128-267 [107138] Other proteins in same PDB: d1tlta1, d1tltb1 Structural genomics target complexed with so4 |
PDB Entry: 1tlt (more details), 2.7 Å
SCOPe Domain Sequences for d1tltb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tltb2 d.81.1.5 (B:128-267) Virulence factor MviM {Escherichia coli [TaxId: 562]} aplygelktqlataaslrmdkhrsnsvgphdlyftllddylhvvdtalwlsggkasldgg tlltndagemlfaehhfsagplqittcmhrragsqretvqavtdgaliditdmrewreer gqgvvhkpipgwqstleqrg
Timeline for d1tltb2: