Lineage for d1tltb2 (1tlt B:128-267)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2527131Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2527132Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 2527649Family d.81.1.5: Glucose 6-phosphate dehydrogenase-like [55376] (7 proteins)
    has many additional secondary structures
  6. 2527734Protein Virulence factor MviM [111052] (1 species)
  7. 2527735Species Escherichia coli [TaxId:562] [111053] (1 PDB entry)
    Uniprot P75931
  8. 2527737Domain d1tltb2: 1tlt B:128-267 [107138]
    Other proteins in same PDB: d1tlta1, d1tltb1
    Structural genomics target
    complexed with so4

Details for d1tltb2

PDB Entry: 1tlt (more details), 2.7 Å

PDB Description: crystal structure of a putative oxidoreductase (virulence factor mvim homolog)
PDB Compounds: (B:) PUTATIVE OXIDOREDUCTASE (VIRULENCE FACTOR mviM HOMOLOG)

SCOPe Domain Sequences for d1tltb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tltb2 d.81.1.5 (B:128-267) Virulence factor MviM {Escherichia coli [TaxId: 562]}
aplygelktqlataaslrmdkhrsnsvgphdlyftllddylhvvdtalwlsggkasldgg
tlltndagemlfaehhfsagplqittcmhrragsqretvqavtdgaliditdmrewreer
gqgvvhkpipgwqstleqrg

SCOPe Domain Coordinates for d1tltb2:

Click to download the PDB-style file with coordinates for d1tltb2.
(The format of our PDB-style files is described here.)

Timeline for d1tltb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tltb1