Lineage for d1tltb2 (1tlt B:128-267)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. Family d.81.1.5: Glucose 6-phosphate dehydrogenase-like [55376] (7 proteins)
    has many additional secondary structures
  6. Protein Virulence factor MviM [111052] (1 species)
  7. Species Escherichia coli [TaxId:562] [111053] (1 PDB entry)
    Uniprot P75931
  8. Domain d1tltb2: 1tlt B:128-267 [107138]
    Other proteins in same PDB: d1tlta1, d1tltb1
    Structural genomics target
    complexed with so4

Details for d1tltb2

PDB Entry: 1tlt (more details), 2.7 Å

PDB Description: crystal structure of a putative oxidoreductase (virulence factor mvim homolog)
PDB Compounds: (B:) PUTATIVE OXIDOREDUCTASE (VIRULENCE FACTOR mviM HOMOLOG)

SCOPe Domain Sequences for d1tltb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tltb2 d.81.1.5 (B:128-267) Virulence factor MviM {Escherichia coli [TaxId: 562]}
aplygelktqlataaslrmdkhrsnsvgphdlyftllddylhvvdtalwlsggkasldgg
tlltndagemlfaehhfsagplqittcmhrragsqretvqavtdgaliditdmrewreer
gqgvvhkpipgwqstleqrg

SCOPe Domain Coordinates for d1tltb2 are not available.

Timeline for d1tltb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tltb1
View in 3D
Domains from other chains:
(mouse over for more information)
d1tlta1, d1tlta2