Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
Protein Virulence factor MviM [110421] (1 species) |
Species Escherichia coli [TaxId:562] [110422] (1 PDB entry) Uniprot P75931 |
Domain d1tltb1: 1tlt B:5-127,B:268-308 [107137] Other proteins in same PDB: d1tlta2, d1tltb2 Structural genomics target complexed with so4 |
PDB Entry: 1tlt (more details), 2.7 Å
SCOPe Domain Sequences for d1tltb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tltb1 c.2.1.3 (B:5-127,B:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} klrigvvglggiaqkawlpvlaaasdwtlqgawsptrakalpiceswripyadslsslaa scdavfvhsstashfdvvstllnagvhvcvdkplaenlrdaerlvelaarkkltlmvgfn rrfXfvgcarhfiecvqnqtvpqtageqavlaqrivdkiwrdams
Timeline for d1tltb1: