![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
![]() | Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) ![]() N-terminal domain is the classic Rossmann-fold |
![]() | Family d.81.1.5: Glucose 6-phosphate dehydrogenase-like [55376] (7 proteins) has many additional secondary structures |
![]() | Protein Virulence factor MviM [111052] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [111053] (1 PDB entry) Uniprot P75931 |
![]() | Domain d1tlta2: 1tlt A:128-267 [107136] Other proteins in same PDB: d1tlta1, d1tltb1 Structural genomics target complexed with so4 |
PDB Entry: 1tlt (more details), 2.7 Å
SCOPe Domain Sequences for d1tlta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tlta2 d.81.1.5 (A:128-267) Virulence factor MviM {Escherichia coli [TaxId: 562]} aplygelktqlataaslrmdkhrsnsvgphdlyftllddylhvvdtalwlsggkasldgg tlltndagemlfaehhfsagplqittcmhrragsqretvqavtdgaliditdmrewreer gqgvvhkpipgwqstleqrg
Timeline for d1tlta2: