Lineage for d1tlta1 (1tlt A:5-127,A:268-308)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2092282Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 protein domains)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 2092881Protein Virulence factor MviM [110421] (1 species)
  7. 2092882Species Escherichia coli [TaxId:562] [110422] (1 PDB entry)
    Uniprot P75931
  8. 2092883Domain d1tlta1: 1tlt A:5-127,A:268-308 [107135]
    Other proteins in same PDB: d1tlta2, d1tltb2
    Structural genomics target
    complexed with so4

Details for d1tlta1

PDB Entry: 1tlt (more details), 2.7 Å

PDB Description: crystal structure of a putative oxidoreductase (virulence factor mvim homolog)
PDB Compounds: (A:) PUTATIVE OXIDOREDUCTASE (VIRULENCE FACTOR mviM HOMOLOG)

SCOPe Domain Sequences for d1tlta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]}
klrigvvglggiaqkawlpvlaaasdwtlqgawsptrakalpiceswripyadslsslaa
scdavfvhsstashfdvvstllnagvhvcvdkplaenlrdaerlvelaarkkltlmvgfn
rrfXfvgcarhfiecvqnqtvpqtageqavlaqrivdkiwrdams

SCOPe Domain Coordinates for d1tlta1:

Click to download the PDB-style file with coordinates for d1tlta1.
(The format of our PDB-style files is described here.)

Timeline for d1tlta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tlta2