Lineage for d1tlqa_ (1tlq A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736339Fold a.195: YutG-like [101306] (1 superfamily)
    core: 6 helices; bundle; one central helix is surrounded by 5 others
  4. 2736340Superfamily a.195.1: YutG-like [101307] (1 family) (S)
  5. 2736341Family a.195.1.1: YutG-like [101308] (3 proteins)
    Pfam PF01892; DUF64
  6. 2736342Protein Hypothetical protein YpjQ [109933] (1 species)
  7. 2736343Species Bacillus subtilis [TaxId:1423] [109934] (1 PDB entry)
    Uniprot P54173
  8. 2736344Domain d1tlqa_: 1tlq A: [107134]
    Structural genomics target
    complexed with ca

Details for d1tlqa_

PDB Entry: 1tlq (more details), 2.4 Å

PDB Description: crystal structure of protein ypjq from bacillus subtilis, pfam duf64
PDB Compounds: (A:) Hypothetical protein ypjQ

SCOPe Domain Sequences for d1tlqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tlqa_ a.195.1.1 (A:) Hypothetical protein YpjQ {Bacillus subtilis [TaxId: 1423]}
ytmnemvditkdmlnkrgvmiediarivqklqekynpnlplsvcmenvekvlnkreiiha
vltglaldqlaeqkllpeplqhlvetdeplygideiiplsivnvygsigltnfgyldkek
igiikeldespdgihtflddivaalaaaaasriahthqdlq

SCOPe Domain Coordinates for d1tlqa_:

Click to download the PDB-style file with coordinates for d1tlqa_.
(The format of our PDB-style files is described here.)

Timeline for d1tlqa_: