![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.195: YutG-like [101306] (1 superfamily) core: 6 helices; bundle; one central helix is surrounded by 5 others |
![]() | Superfamily a.195.1: YutG-like [101307] (1 family) ![]() |
![]() | Family a.195.1.1: YutG-like [101308] (3 proteins) Pfam PF01892; DUF64 |
![]() | Protein Hypothetical protein YpjQ [109933] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [109934] (1 PDB entry) Uniprot P54173 |
![]() | Domain d1tlqa_: 1tlq A: [107134] Structural genomics target complexed with ca |
PDB Entry: 1tlq (more details), 2.4 Å
SCOPe Domain Sequences for d1tlqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tlqa_ a.195.1.1 (A:) Hypothetical protein YpjQ {Bacillus subtilis [TaxId: 1423]} ytmnemvditkdmlnkrgvmiediarivqklqekynpnlplsvcmenvekvlnkreiiha vltglaldqlaeqkllpeplqhlvetdeplygideiiplsivnvygsigltnfgyldkek igiikeldespdgihtflddivaalaaaaasriahthqdlq
Timeline for d1tlqa_: