![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) ![]() binds NADP differently than classical Rossmann-fold N-terminal FAD-linked domain contains (6,10) barrel |
![]() | Family c.25.1.4: NADPH-cytochrome p450 reductase-like [52365] (3 proteins) |
![]() | Protein Neuronal nitric-oxide synthase FAD/NADP+ domain [69451] (1 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [69452] (2 PDB entries) Uniprot P29476 750-1413 |
![]() | Domain d1tllb3: 1tll B:3233-3413 [107133] Other proteins in same PDB: d1tlla1, d1tlla2, d1tllb1, d1tllb2 complexed with fad, fmn, nap, so3 |
PDB Entry: 1tll (more details), 2.3 Å
SCOPe Domain Sequences for d1tllb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tllb3 c.25.1.4 (B:3233-3413) Neuronal nitric-oxide synthase FAD/NADP+ domain {Norway rat (Rattus norvegicus) [TaxId: 10116]} sfhlprnpqvpcilvgpgtgiapfrsfwqqrqfdiqhkgmnpcpmvlvfgcrqskidhiy reetlqaknkgvfrelytaysrepdrpkkyvqdvlqeqlaesvyralkeqgghiyvcgdv tmaadvlkaiqrimtqqgklseedagvfisrlrddnryhedifgvtlrtyevtnrlrses i
Timeline for d1tllb3: