Lineage for d1tllb3 (1tll B:3233-3413)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2859730Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2859731Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 2859873Family c.25.1.4: NADPH-cytochrome p450 reductase-like [52365] (3 proteins)
  6. 2859884Protein Neuronal nitric-oxide synthase FAD/NADP+ domain [69451] (1 species)
  7. 2859885Species Norway rat (Rattus norvegicus) [TaxId:10116] [69452] (2 PDB entries)
    Uniprot P29476 750-1413
  8. 2859888Domain d1tllb3: 1tll B:3233-3413 [107133]
    Other proteins in same PDB: d1tlla1, d1tlla2, d1tllb1, d1tllb2
    complexed with fad, fmn, nap, so3

Details for d1tllb3

PDB Entry: 1tll (more details), 2.3 Å

PDB Description: crystal structure of rat neuronal nitric-oxide synthase reductase module at 2.3 a resolution.
PDB Compounds: (B:) Nitric-oxide synthase, brain

SCOPe Domain Sequences for d1tllb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tllb3 c.25.1.4 (B:3233-3413) Neuronal nitric-oxide synthase FAD/NADP+ domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
sfhlprnpqvpcilvgpgtgiapfrsfwqqrqfdiqhkgmnpcpmvlvfgcrqskidhiy
reetlqaknkgvfrelytaysrepdrpkkyvqdvlqeqlaesvyralkeqgghiyvcgdv
tmaadvlkaiqrimtqqgklseedagvfisrlrddnryhedifgvtlrtyevtnrlrses
i

SCOPe Domain Coordinates for d1tllb3:

Click to download the PDB-style file with coordinates for d1tllb3.
(The format of our PDB-style files is described here.)

Timeline for d1tllb3: