Lineage for d1tllb2 (1tll B:2752-2952)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2856357Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2856501Family c.23.5.2: Cytochrome p450 reductase N-terminal domain-like [52231] (3 proteins)
  6. 2856513Protein Nitric oxide (NO) synthase FMN domain [110468] (1 species)
  7. 2856514Species Norway rat (Rattus norvegicus) [TaxId:10116] [110469] (1 PDB entry)
    Uniprot P29476 750-1413
  8. 2856516Domain d1tllb2: 1tll B:2752-2952 [107132]
    Other proteins in same PDB: d1tlla1, d1tlla3, d1tllb1, d1tllb3
    complexed with fad, fmn, nap, so3

Details for d1tllb2

PDB Entry: 1tll (more details), 2.3 Å

PDB Description: crystal structure of rat neuronal nitric-oxide synthase reductase module at 2.3 a resolution.
PDB Compounds: (B:) Nitric-oxide synthase, brain

SCOPe Domain Sequences for d1tllb2:

Sequence, based on SEQRES records: (download)

>d1tllb2 c.23.5.2 (B:2752-2952) Nitric oxide (NO) synthase FMN domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rvkatilyatetgksqayaktlceifkhafdakamsmeeydivhlehealvlvvtstfgn
gdppengekfgcalmemrhpnsvqeerksykvrfnsvssysdsrkssgdgpdlrdnfest
gplanvrfsvfglgsrayphfcafghavdtlleelggerilkmregdelcgqeeafrtwa
kkvfkaacdvfcvgddvniek

Sequence, based on observed residues (ATOM records): (download)

>d1tllb2 c.23.5.2 (B:2752-2952) Nitric oxide (NO) synthase FMN domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rvkatilyatetgksqayaktlceifkhafdakamsmeeydivhlehealvlvvtstfgn
gdppengekfgcalmemrsykvrfnvrfsvfglgsrayphfcafghavdtlleelggeri
lkmregdelcgqeeafrtwakkvfkaacdvfcvgddvniek

SCOPe Domain Coordinates for d1tllb2:

Click to download the PDB-style file with coordinates for d1tllb2.
(The format of our PDB-style files is described here.)

Timeline for d1tllb2: