Lineage for d1tlla2 (1tll A:750-951)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2102350Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2102485Family c.23.5.2: Cytochrome p450 reductase N-terminal domain-like [52231] (3 protein domains)
  6. 2102497Protein Nitric oxide (NO) synthase FMN domain [110468] (1 species)
  7. 2102498Species Norway rat (Rattus norvegicus) [TaxId:10116] [110469] (1 PDB entry)
    Uniprot P29476 750-1413
  8. 2102499Domain d1tlla2: 1tll A:750-951 [107129]
    Other proteins in same PDB: d1tlla1, d1tlla3, d1tllb1, d1tllb3
    complexed with fad, fmn, nap, so3

Details for d1tlla2

PDB Entry: 1tll (more details), 2.3 Å

PDB Description: crystal structure of rat neuronal nitric-oxide synthase reductase module at 2.3 a resolution.
PDB Compounds: (A:) Nitric-oxide synthase, brain

SCOPe Domain Sequences for d1tlla2:

Sequence, based on SEQRES records: (download)

>d1tlla2 c.23.5.2 (A:750-951) Nitric oxide (NO) synthase FMN domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
akrvkatilyatetgksqayaktlceifkhafdakamsmeeydivhlehealvlvvtstf
gngdppengekfgcalmemrhpnsvqeerksykvrfnsvssysdsrkssgdgpdlrdnfe
stgplanvrfsvfglgsrayphfcafghavdtlleelggerilkmregdelcgqeeafrt
wakkvfkaacdvfcvgddvnie

Sequence, based on observed residues (ATOM records): (download)

>d1tlla2 c.23.5.2 (A:750-951) Nitric oxide (NO) synthase FMN domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
akrvkatilyatetgksqayaktlceifkhafdakamsmeeydivhlehealvlvvtstf
gngdppengekfgcalmemrheerksykvrfnsvsgplanvrfsvfglgsrayphfcafg
havdtlleelggerilkmregdelcgqeeafrtwakkvfkaacdvfcvgddvnie

SCOPe Domain Coordinates for d1tlla2:

Click to download the PDB-style file with coordinates for d1tlla2.
(The format of our PDB-style files is described here.)

Timeline for d1tlla2: