SCOPe 2.05: Domain d1tlla1: 1tll A:959-1232

Lineage for d1tlla1 (1tll A:959-1232)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families)

5. Family b.43.4.1: NADPH-cytochrome p450 reductase FAD-binding domain-like [50438] (4 proteins)
   there is an alpha-helical subdomain inserted in this domain
   automatically mapped to Pfam PF00667

6. Protein Neuronal nitric-oxide synthase FAD/NADP+ domain [69274] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [69275] (2 PDB entries)
   Uniprot P29476 750-1413

8. Domain d1tlla1: 1tll A:959-1232 [107128]
   Other proteins in same PDB: d1tlla2, d1tlla3, d1tllb2, d1tllb3
   complexed with fad, fmn, nap, so3

Details for d1tlla1

PDB Entry: 1tll, 2.3 Å

PDB Description: crystal structure of rat neuronal nitric-oxide synthase reductase module at 2.3 a resolution.

PDB Compounds: (A:) Nitric-oxide synthase, brain

SCOPe Domain Sequences for d1tlla1:

Sequence; same for both SEQRES and ATOM records:

>d1tlla1 b.43.4.1 (A:959-1232) Neuronal nitric-oxide synthase FAD/NADP+ domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
sndrswkrnkfrltyvaeapdltqglsnvhkkrvsaarllsrqnlqspkssrstifvrlh
tngnqelqyqpgdhlgvfpgnhedlvnalierledappanhvvkvemleerntalgvisn
wkdesrlppctifqafkyyldittpptplqlqqfaslatnekekqrllvlskglqeyeew
kwgknptmvevleefpsiqmpatllltqlsllqpryysissspdmypdevhltvaivsyh
trdgegpvhhgvcsswlnriqaddvvpcfvrgap

Timeline for d1tlla1:

• d1tlla1 first appeared in SCOP 1.69
  
• d1tlla1 appears in SCOPe 2.04
  
• d1tlla1 appears in SCOPe 2.06
  
• d1tlla1 appears in the current release, SCOPe 2.08